Pay in 4 interest-free payments of $5.34 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
43 amino acids Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNTLPTKETIEQEKQAGES Formula / M.W.: C 212 H 350 N 56 O 78 S, ~4963.44 g/mol CAS: 77591-33-4 Disclaimer This product is intended for laboratory research use only
Ive done 2 injections so far and my appetite is definitely decreased The change in my appetite is really remarkable
Incorrect reconstitution can compromise the integrity of the peptide and produce unreliable research results
Common Side Effects: Mild and temporary soreness, redness at the injection site, or mild diarrhea are the most common reactions
The peptide's ability to modulate gene expression patternsinfluencing 31% of the human genomeenables comprehensive effects on follicular stem cells, growth factor production, and structural protein synthesis essential for robust hair formation
Surgeons may recommend bone marrow transplant in situations where the patients bone marrow is affected by disease and cannot produce healthy blood cells
US$ 22.31
US$ 27.57
US$ 20.98
US$ 23.05
US$ 23.64
US$ 27.18